PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.21982s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 518aa    MW: 55920.6 Da    PI: 6.2384
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.21982s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.91.1e-2864117155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv av+qL G ekA+Pk+ilelm+v+gLt+e+v+SHLQkYR+
  Araha.21982s0001.1.p  64 KPRVVWSVELHQQFVAAVNQL-GVEKAVPKKILELMNVPGLTRENVASHLQKYRI 117
                           79*******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.5461120IPR017930Myb domain
SuperFamilySSF466891.13E-1962121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-3063122IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2464117IPR006447Myb domain, plants
PfamPF002493.1E-866116IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
ERQQQQHRGG GGGAAVSGGE DAVDDNSSSV NEGNNWRSSS RKRKDEEGEE QGDDKDEDAS  60
NLKKPRVVWS VELHQQFVAA VNQLGVEKAV PKKILELMNV PGLTRENVAS HLQKYRIYLR  120
RLGGVSQHQG NLNNSFMTGQ DASFGPLSTL NGFDLQALAV TGQLPAQSLA QLQAAGLGRP  180
AMVSKSGLPV SSIVDERSIF SFDNTKTRFG EGLGHHGQQP QQQPQMNLLH GVPTGLQQQL  240
PMGNRMSIQQ QIAAVRAGHS VQNSGMLMPL AGQQSLPRGP PSMLTSSQSS IRQPMLSNRI  300
SERSGFSGRN NIPESSRVLP TGYTNLTTQH SSSAMAYNNY QTELPVNSFP LASAPGLSVP  360
VRKATSYQEE VNSSEAGFTS PSYDMFTTRQ NDWDLRNIGI AFDSHQDAES AAFSASEAYS  420
SSSMSRNNTT VAATEHGRNH QQPPPGMVPH HQGYADGNSG SVRVKSERVA ADTAAMAFHE  480
QYSNQEDLMS ALLKQEGIAP VDGEFDFDAY SIDNIPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2363122463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1764890.0AK176489.1 Arabidopsis thaliana mRNA for putative ARR1 protein, complete cds, clone: RAFL24-30-K07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297106.10.0hypothetical protein CARUB_v10013107mg
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLR0HK040.0R0HK04_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1853__AT3G16857.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1